NUDT16L1 anticorps
-
- Antigène Voir toutes NUDT16L1 Anticorps
- NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NUDT16L1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- NUDT16 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE
- Top Product
- Discover our top product NUDT16L1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NUDT16L1 Blocking Peptide, catalog no. 33R-3430, is also available for use as a blocking control in assays to test for specificity of this NUDT16L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))
- Autre désignation
- NUDT16L1 (NUDT16L1 Produits)
- Synonymes
- anticorps SDOS, anticorps 1110001K21Rik, anticorps 5330437I08Rik, anticorps Sdos, anticorps nudix hydrolase 16 like 1, anticorps nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1, anticorps NUDT16L1, anticorps Nudt16l1
- Sujet
- NUDT16L1 is a probable adapter protein, which may link syndecan-4 (SDC4) and paxilin (TGFB1I1 and PXN) receptors.
- Poids moléculaire
- 23 kDa (MW of target protein)
-