NUDT16L1 anticorps

N° du produit ABIN629838

Détail du produit anti-NUDT16L1 anticorps

Antigène: NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUDT16L1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: NUDT16 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUDT16L1 Blocking Peptide, catalog no. 33R-3430, is also available for use as a blocking control in assays to test for specificity of this NUDT16L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUDT16L1

Antigène: NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))

Autre désignation: NUDT16L1 (NUDT16L1 Produits)

Synonymes: anticorps SDOS, anticorps 1110001K21Rik, anticorps 5330437I08Rik, anticorps Sdos, anticorps nudix hydrolase 16 like 1, anticorps nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1, anticorps NUDT16L1, anticorps Nudt16l1

Sujet: NUDT16L1 is a probable adapter protein, which may link syndecan-4 (SDC4) and paxilin (TGFB1I1 and PXN) receptors.

Poids moléculaire: 23 kDa (MW of target protein)