ACP1 anticorps (N-Term)

N° du produit ABIN629849

Détail du produit anti-ACP1 anticorps

Antigène: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ACP1 antibody was raised against the N terminal of ACP1

Purification: Purified

Immunogène: ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACP1 Blocking Peptide, catalog no. 33R-7150, is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACP1

Antigène: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Autre désignation: ACP1 (ACP1 Produits)

Synonymes: anticorps HAAP, anticorps 4632432E04Rik, anticorps AI427468, anticorps Acp-1, anticorps LMW-PTP, anticorps haap, anticorps lmw-ptp, anticorps ptp1a, anticorps xlptp1, anticorps im:6910498, anticorps zgc:110844, anticorps Acp1, anticorps ACYPI006806, anticorps ACP, anticorps ACPH, anticorps APH, anticorps Acph, anticorps CG7899, anticorps Dmel\\CG7899, anticorps DDBDRAFT_0189318, anticorps DDBDRAFT_0266663, anticorps DDB_0189318, anticorps DDB_0266663, anticorps ACP1, anticorps XLPTP1, anticorps acp1, anticorps acp1a, anticorps ptp1a-A, anticorps LMW-PTPase, anticorps acid phosphatase 1, anticorps acid phosphatase 1, soluble, anticorps Acid phosphatase 1, anticorps acid phosphatase 1 L homeolog, anticorps ACP1, anticorps Acp1, anticorps acp1, anticorps Acph-1, anticorps acp1.L

Sujet: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate.

Poids moléculaire: 17 kDa (MW of target protein)