ACP1 anticorps (N-Term)
-
- Antigène Voir toutes ACP1 Anticorps
- ACP1 (Acid Phosphatase 1, Soluble (ACP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACP1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ACP1 antibody was raised against the N terminal of ACP1
- Purification
- Purified
- Immunogène
- ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP
- Top Product
- Discover our top product ACP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACP1 Blocking Peptide, catalog no. 33R-7150, is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACP1 (Acid Phosphatase 1, Soluble (ACP1))
- Autre désignation
- ACP1 (ACP1 Produits)
- Synonymes
- anticorps HAAP, anticorps 4632432E04Rik, anticorps AI427468, anticorps Acp-1, anticorps LMW-PTP, anticorps haap, anticorps lmw-ptp, anticorps ptp1a, anticorps xlptp1, anticorps im:6910498, anticorps zgc:110844, anticorps Acp1, anticorps ACYPI006806, anticorps ACP, anticorps ACPH, anticorps APH, anticorps Acph, anticorps CG7899, anticorps Dmel\\CG7899, anticorps DDBDRAFT_0189318, anticorps DDBDRAFT_0266663, anticorps DDB_0189318, anticorps DDB_0266663, anticorps ACP1, anticorps XLPTP1, anticorps acp1, anticorps acp1a, anticorps ptp1a-A, anticorps LMW-PTPase, anticorps acid phosphatase 1, anticorps acid phosphatase 1, soluble, anticorps Acid phosphatase 1, anticorps acid phosphatase 1 L homeolog, anticorps ACP1, anticorps Acp1, anticorps acp1, anticorps Acph-1, anticorps acp1.L
- Sujet
- ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate.
- Poids moléculaire
- 17 kDa (MW of target protein)
-