PLIN1 anticorps (N-Term)

N° du produit ABIN629870

L’anticorps Lapin Polyclonal anti-PLIN1 a été validé pour WB. Il convient pour détecter PLIN1 dans des échantillons de Humain, Souris, Rat et Chien. Il y a 1 publication disponible.

Aperçu rapide pour PLIN1 anticorps (N-Term) (ABIN629870)

Antigène: PLIN1 (Perilipin 1 (PLIN1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLIN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLIN1 anticorps

Épitope: N-Term

Specificité: Perilipin antibody was raised against the N terminal of PLIN

Purification: Purified

Immunogène: Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Perilipin Blocking Peptide, (ABIN5615312), is also available for use as a blocking control in assays to test for specificity of this Perilipin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-PLIN1 (ABIN629870)

Rudolph, Jackman, Presby, Houck, Webb, Johnson, Soderborg, de la Houssaye, Yang, Friedman, MacLean: "Low Neonatal Plasma n-6/n-3 PUFA Ratios Regulate Offspring Adipogenic Potential and Condition Adult Obesity Resistance." dans: Diabetes, Vol. 67, Issue 4, pp. 651-661, (2018) (PubMed).

Détails sur PLIN1

Antigène: PLIN1 (Perilipin 1 (PLIN1))

Autre désignation: Perilipin

Sujet: PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Lipid Metabolism