NXF5 anticorps (Middle Region)

N° du produit ABIN629931

Détail du produit anti-NXF5 anticorps

Antigène: NXF5 (Nuclear RNA Export Factor 5 (NXF5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NXF5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: NXF5 antibody was raised against the middle region of NXF5

Purification: Purified

Immunogène: NXF5 antibody was raised using the middle region of NXF5 corresponding to a region with amino acids ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NXF5 Blocking Peptide, catalog no. 33R-4173, is also available for use as a blocking control in assays to test for specificity of this NXF5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NXF5

Antigène: NXF5 (Nuclear RNA Export Factor 5 (NXF5))

Autre désignation: NXF5 (NXF5 Produits)

Synonymes: anticorps NXF2B, anticorps nuclear RNA export factor 5, anticorps nuclear RNA export factor 2, anticorps NXF5, anticorps LOC609849, anticorps Nxf5

Sujet: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.

Poids moléculaire: 44 kDa (MW of target protein)