HNRNPA0 anticorps (Middle Region)

N° du produit ABIN629936

Détail du produit anti-HNRNPA0 anticorps

Antigène: HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPA0 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HNRPA0 antibody was raised against the middle region of HNRPA0

Purification: Purified

Immunogène: HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG

Information d'application

Indications d'application: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPA0 Blocking Peptide, catalog no. 33R-4234, is also available for use as a blocking control in assays to test for specificity of this HNRPA0 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPA0

Antigène: HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))

Autre désignation: HNRPA0 (HNRNPA0 Produits)

Synonymes: anticorps HNRPA0, anticorps 1110055B05Rik, anticorps 3010025E17Rik, anticorps Hnrpa0, anticorps hnRNP A0, anticorps fc01g05, anticorps wu:fc01g05, anticorps zgc:77366, anticorps fi36h08, anticorps hnrnpa0, anticorps hnrpa0, anticorps wu:fa16d06, anticorps wu:fi36h08, anticorps zgc:77280, anticorps MGC53160, anticorps MGC130809, anticorps RGD1563684, anticorps HNRNPA0, anticorps heterogeneous nuclear ribonucleoprotein A0, anticorps heterogeneous nuclear ribonucleoprotein A0a, anticorps heterogeneous nuclear ribonucleoprotein A0b, anticorps heterogeneous nuclear ribonucleoprotein A0 L homeolog, anticorps Heterogeneous nuclear ribonucleoprotein A0, anticorps HNRNPA0, anticorps Hnrnpa0, anticorps hnrnpa0a, anticorps hnrnpa0b, anticorps hnrpa0, anticorps hnrnpa0, anticorps hnrnpa0.L, anticorps roa0

Sujet: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Poids moléculaire: 34 kDa (MW of target protein)