MRM1 anticorps

N° du produit ABIN629965

Détail du produit anti-MRM1 anticorps

Antigène: MRM1 (Mitochondrial rRNA Methyltransferase 1 Homolog (MRM1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRM1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: MRM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRM1 Blocking Peptide, catalog no. 33R-3623, is also available for use as a blocking control in assays to test for specificity of this MRM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRM1

Antigène: MRM1 (Mitochondrial rRNA Methyltransferase 1 Homolog (MRM1))

Autre désignation: MRM1 (MRM1 Produits)

Synonymes: anticorps A530065E19Rik, anticorps ENSMUSG00000054212, anticorps RGD1566232, anticorps mitochondrial rRNA methyltransferase 1, anticorps MRM1, anticorps Mrm1

Sujet: MRM1 belongs to the RNA methyltransferase trmH family and probably methylates the ribose of guanosine G-2270 in the peptidyl transferase center of the mitochondrial large ribosomal RNA (21S)

Poids moléculaire: 18 kDa (MW of target protein)