SFPQ anticorps
-
- Antigène Voir toutes SFPQ Anticorps
- SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SFPQ est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
- Top Product
- Discover our top product SFPQ Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFPQ Blocking Peptide, catalog no. 33R-9727, is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))
- Autre désignation
- SFPQ (SFPQ Produits)
- Synonymes
- anticorps 1110004P21Rik, anticorps 2810416M14Rik, anticorps 5730453G22Rik, anticorps 9030402K04Rik, anticorps AU021830, anticorps D4Ertd314e, anticorps Gm12940, anticorps OTTMUSG00000009329, anticorps PSF, anticorps REP1, anticorps hm:zeh0027, anticorps wu:fa11h12, anticorps wu:fd10f03, anticorps zgc:85935, anticorps POMP100, anticorps splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated), anticorps splicing factor proline/glutamine-rich, anticorps splicing factor proline and glutamine rich, anticorps Sfpq, anticorps sfpq, anticorps SFPQ
- Sujet
- SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.
- Poids moléculaire
- 78 kDa (MW of target protein)
-