CACNG6 anticorps (N-Term)

N° du produit ABIN630072

Détail du produit anti-CACNG6 anticorps

Antigène: CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACNG6 est non-conjugé

Application: Western Blotting (WB)

Specificité: CACNG6 antibody was raised against the N terminal of CACNG6

Purification: Purified

Immunogène: CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACNG6 Blocking Peptide, catalog no. 33R-7808, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACNG6

Antigène: CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))

Autre désignation: CACNG6 (CACNG6 Produits)

Synonymes: anticorps CACNG6, anticorps cacng6, anticorps MGC122711, anticorps 2310033H20Rik, anticorps AW050150, anticorps calcium voltage-gated channel auxiliary subunit gamma 6, anticorps calcium channel, voltage-dependent, gamma subunit 6, anticorps CACNG6, anticorps cacng6, anticorps Cacng6

Sujet: L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

Poids moléculaire: 24 kDa (MW of target protein)