VDAC1 anticorps (C-Term)

N° du produit ABIN630114

Détail du produit anti-VDAC1 anticorps

Antigène: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VDAC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: VDAC1 antibody was raised against the C terminal of VDAC1

Purification: Purified

Immunogène: VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VDAC1 Blocking Peptide, catalog no. 33R-8303, is also available for use as a blocking control in assays to test for specificity of this VDAC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VDAC1

Antigène: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Autre désignation: VDAC1 (VDAC1 Produits)

Synonymes: anticorps vdac1, anticorps VDAC1, anticorps 5076, anticorps ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, anticorps ATVDAC1, anticorps T22N4.9, anticorps T22N4_9, anticorps voltage dependent anion channel 1, anticorps PORIN, anticorps VDAC-1, anticorps AL033343, anticorps Vdac5, anticorps fa13f11, anticorps wu:fa13f11, anticorps zgc:85830, anticorps voltage-dependent anion channel 1 S homeolog, anticorps voltage-dependent anion channel 1, anticorps voltage dependent anion channel 1, anticorps vdac1.S, anticorps vdac1, anticorps VDAC1, anticorps Vdac1

Sujet: The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.

Poids moléculaire: 31 kDa (MW of target protein)