TRPM3 anticorps (N-Term)
-
- Antigène Voir toutes TRPM3 Anticorps
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRPM3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRPM3 antibody was raised against the N terminal of TRPM3
- Purification
- Purified
- Immunogène
- TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD
- Top Product
- Discover our top product TRPM3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRPM3 Blocking Peptide, catalog no. 33R-1376, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
- Autre désignation
- TRPM3 (TRPM3 Produits)
- Synonymes
- anticorps GON-2, anticorps LTRPC3, anticorps MLSN2, anticorps 6330504P12Rik, anticorps 9330180E14, anticorps AU018608, anticorps B930001P07Rik, anticorps si:dkey-201c13.4, anticorps trpm6, anticorps transient receptor potential cation channel subfamily M member 3, anticorps transient receptor potential cation channel, subfamily M, member 3, anticorps TRPM3, anticorps Trpm3, anticorps trpm3
- Sujet
- TRPM3 encodes a protein that belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The encoded protein mediates calcium entry, and this entry is potentiated by calcium store depletion.
- Poids moléculaire
- 188 kDa (MW of target protein)
-