TRPM3 anticorps (N-Term)

N° du produit ABIN630116

Détail du produit anti-TRPM3 anticorps

Antigène: TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPM3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPM3 antibody was raised against the N terminal of TRPM3

Purification: Purified

Immunogène: TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPM3 Blocking Peptide, catalog no. 33R-1376, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPM3

Antigène: TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))

Autre désignation: TRPM3 (TRPM3 Produits)

Synonymes: anticorps GON-2, anticorps LTRPC3, anticorps MLSN2, anticorps 6330504P12Rik, anticorps 9330180E14, anticorps AU018608, anticorps B930001P07Rik, anticorps si:dkey-201c13.4, anticorps trpm6, anticorps transient receptor potential cation channel subfamily M member 3, anticorps transient receptor potential cation channel, subfamily M, member 3, anticorps TRPM3, anticorps Trpm3, anticorps trpm3

Sujet: TRPM3 encodes a protein that belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The encoded protein mediates calcium entry, and this entry is potentiated by calcium store depletion.

Poids moléculaire: 188 kDa (MW of target protein)