PROC anticorps

N° du produit ABIN630170

Détail du produit anti-PROC anticorps

Antigène: PROC (Vitamin K-dependent protein C (PROC))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PROC est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Protein C Blocking Peptide, catalog no. 33R-6620, is also available for use as a blocking control in assays to test for specificity of this Protein C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PROC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PROC

Antigène: PROC (Vitamin K-dependent protein C (PROC))

Autre désignation: Protein C (PROC Produits)

Synonymes: anticorps proc, anticorps si:ch1073-188c16.3, anticorps zgc:63987, anticorps PROC, anticorps APC, anticorps PC, anticorps PROC1, anticorps THPH3, anticorps THPH4, anticorps proc1, anticorps MGC64425, anticorps PA, anticorps protein C, inactivator of coagulation factors Va and VIIIa, anticorps protein C (inactivator of coagulation factors Va and VIIIa), a, anticorps protein C (inactivator of coagulation factors Va and VIIIa), anticorps protein C, inactivator of coagulation factors Va and VIIIa S homeolog, anticorps vitamin K-dependent protein C, anticorps prosaposin, anticorps protein C, anticorps proline rich protein HaeIII subfamily 1, anticorps PROC, anticorps proca, anticorps proc.S, anticorps proc, anticorps CpipJ_CPIJ000393, anticorps CpipJ_CPIJ002754, anticorps CpipJ_CPIJ003717, anticorps CpipJ_CPIJ003718, anticorps CpipJ_CPIJ014440, anticorps CpipJ_CPIJ018032, anticorps CpipJ_CPIJ018737, anticorps PSAP, anticorps Proc, anticorps PRH1

Classe de substances: Viral Protein

Sujet: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.

Poids moléculaire: 52 kDa (MW of target protein)