PIK3CB anticorps (C-Term)

N° du produit ABIN630206

L’anticorps anti-PIK3CB Polyclonal Lapin est utilisé pour la détection de PIK3CB dans des échantillons de Humain, Souris, Rat et Chien. Il a été validé pour WB.

Aperçu rapide pour PIK3CB anticorps (C-Term) (ABIN630206)

Antigène: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIK3CB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIK3CB anticorps

Épitope: C-Term

Specificité: PIK3 CB antibody was raised against the C terminal of PIK3 B

Purification: Purified

Immunogène: PIK3 CB antibody was raised using the C terminal of PIK3 B corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIK3CB Blocking Peptide, (ABIN5615375), is also available for use as a blocking control in assays to test for specificity of this PIK3CB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIK3CB

Antigène: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Autre désignation: PIK3CB

Sujet: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110 kDa catalytic subunit, such as PIK3CB, and an 85 kDa adaptor subunit.

Poids moléculaire: 123 kDa (MW of target protein)