GJB4 anticorps (Middle Region)

N° du produit ABIN630263

Détail du produit anti-GJB4 anticorps

Antigène: GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJB4 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJB4 antibody was raised against the middle region of GJB4

Purification: Purified

Immunogène: GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJB4 Blocking Peptide, catalog no. 33R-1774, is also available for use as a blocking control in assays to test for specificity of this GJB4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJB4

Antigène: GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))

Autre désignation: GJB4 (GJB4 Produits)

Synonymes: anticorps GJB4, anticorps Cnx30.3, anticorps Cx30.3, anticorps Gjb-4, anticorps CX30.3, anticorps EKV, anticorps gap junction protein beta 4, anticorps gap junction protein, beta 4, anticorps GJB4, anticorps Gjb4

Sujet: Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. The GJB4 gene encodes connexin 30.3 (Cx30.3) A mutation in connexin 30.3 is causally involved in erythrokeratodermia variabilis (EKV), a mostly autosomal dominant disorder of keratinization.

Poids moléculaire: 29 kDa (MW of target protein)