GJB4 anticorps (Middle Region)
-
- Antigène Voir toutes GJB4 Anticorps
- GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GJB4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GJB4 antibody was raised against the middle region of GJB4
- Purification
- Purified
- Immunogène
- GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
- Top Product
- Discover our top product GJB4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GJB4 Blocking Peptide, catalog no. 33R-1774, is also available for use as a blocking control in assays to test for specificity of this GJB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))
- Autre désignation
- GJB4 (GJB4 Produits)
- Synonymes
- anticorps GJB4, anticorps Cnx30.3, anticorps Cx30.3, anticorps Gjb-4, anticorps CX30.3, anticorps EKV, anticorps gap junction protein beta 4, anticorps gap junction protein, beta 4, anticorps GJB4, anticorps Gjb4
- Sujet
- Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. The GJB4 gene encodes connexin 30.3 (Cx30.3) A mutation in connexin 30.3 is causally involved in erythrokeratodermia variabilis (EKV), a mostly autosomal dominant disorder of keratinization.
- Poids moléculaire
- 29 kDa (MW of target protein)
-