PTK2B anticorps (C-Term)

N° du produit ABIN630279

Cet anticorps anti-PTK2B est un anticorps Lapin Polyclonal détectant PTK2B dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour PTK2B anticorps (C-Term) (ABIN630279)

Antigène: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTK2B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PTK2B anticorps

Épitope: C-Term

Specificité: PTK2 B antibody was raised against the C terminal of PTK2

Purification: Purified

Immunogène: PTK2 B antibody was raised using the C terminal of PTK2 corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTK2B Blocking Peptide, (ABIN5615657), is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTK2B

Antigène: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Autre désignation: PTK2B

Sujet: PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity.

Poids moléculaire: 116 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Cellular Glucan Metabolic Process, Cell-Cell Junction Organization, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Positive Regulation of fat Cell Differentiation, VEGF Signaling