NELL2 anticorps

N° du produit ABIN630282

Détail du produit anti-NELL2 anticorps

Antigène: NELL2 (NEL-Like 2 (Chicken) (NELL2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NELL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NELL2 Blocking Peptide, catalog no. 33R-5966, is also available for use as a blocking control in assays to test for specificity of this NELL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NELL2

Antigène: NELL2 (NEL-Like 2 (Chicken) (NELL2))

Autre désignation: NELL2 (NELL2 Produits)

Synonymes: anticorps A330108N19Rik, anticorps R75516, anticorps mel91, anticorps nel, anticorps NRP2, anticorps nell2, anticorps wu:fj43h11, anticorps zgc:158375, anticorps neural EGFL like 2 L homeolog, anticorps NEL-like 2, anticorps neural EGFL like 2, anticorps neural EGFL like 2a, anticorps nell2.L, anticorps Nell2, anticorps NELL2, anticorps nell2a

Sujet: NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis.

Poids moléculaire: 91 kDa (MW of target protein)