SLC25A14 anticorps

N° du produit ABIN630323

Détail du produit anti-SLC25A14 anticorps

Antigène: SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A14 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: SLC25 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A14 Blocking Peptide, catalog no. 33R-8540, is also available for use as a blocking control in assays to test for specificity of this SLC25A14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A14

Antigène: SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))

Autre désignation: SLC25A14 (SLC25A14 Produits)

Synonymes: anticorps ATPUMP5, anticorps DIC1, anticorps DICARBOXYLATE CARRIER 1, anticorps F14M13.10, anticorps F14M13_10, anticorps PLANT UNCOUPLING MITOCHONDRIAL PROTEIN 5, anticorps uncoupling protein 5, anticorps zgc:55596, anticorps BMCP1, anticorps UCP5, anticorps BMCP-1, anticorps Ucp5, anticorps UCP5L, anticorps UCP5S, anticorps Bmcp1, anticorps solute carrier family 25 member 14, anticorps uncoupling protein 5, anticorps solute carrier family 25 (mitochondrial carrier, brain), member 14, anticorps SLC25A14, anticorps UCP5, anticorps slc25a14, anticorps Slc25a14

Sujet: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Proton Transport