SLC26A8 anticorps (C-Term)
-
- Antigène Voir toutes SLC26A8 Anticorps
- SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))
-
Épitope
- C-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC26A8 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificité
- SLC26 A8 antibody was raised against the C terminal of SLC26 8
- Purification
- Purified
- Immunogène
- SLC26 A8 antibody was raised using the C terminal of SLC26 8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV
- Top Product
- Discover our top product SLC26A8 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC26A8 Blocking Peptide, catalog no. 33R-2643, is also available for use as a blocking control in assays to test for specificity of this SLC26A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))
- Autre désignation
- SLC26A8 (SLC26A8 Produits)
- Synonymes
- anticorps SPGF3, anticorps TAT1, anticorps SLC26A8, anticorps MCT10, anticorps PRO0813, anticorps solute carrier family 26 member 8, anticorps solute carrier family 26, member 8, anticorps solute carrier family 16 member 10, anticorps SLC26A8, anticorps Slc26a8, anticorps SLC16A10
- Sujet
- SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-