ELOVL7 anticorps

N° du produit ABIN630361

Détail du produit anti-ELOVL7 anticorps

Antigène: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELOVL7 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELOVL7 Blocking Peptide, catalog no. 33R-5651, is also available for use as a blocking control in assays to test for specificity of this ELOVL7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELOVL7

Antigène: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Autre désignation: ELOVL7 (ELOVL7 Produits)

Synonymes: anticorps 9130013K24Rik, anticorps AI840082, anticorps elovl1, anticorps wu:fd20a06, anticorps zgc:56422, anticorps cgpr01, anticorps elovl7, anticorps fi36f02, anticorps wu:fi36f02, anticorps zgc:55879, anticorps ELOVL fatty acid elongase 7, anticorps Elongation of very long chain fatty acids protein 7, anticorps elongation of very long chain fatty acids protein 7, anticorps ELOVL family member 7, elongation of long chain fatty acids (yeast), anticorps ELOVL fatty acid elongase 7b, anticorps ELOVL fatty acid elongase 7 L homeolog, anticorps ELOVL fatty acid elongase 7a, anticorps ELOVL7, anticorps elov7, anticorps Elovl7, anticorps elovl7b, anticorps elovl7.L, anticorps elovl7a

Sujet: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.

Poids moléculaire: 33 kDa (MW of target protein)