ELOVL7 anticorps

N° du produit ABIN630361

Cet anticorps Lapin Polyclonal détecte spécifiquement ELOVL7 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour ELOVL7 anticorps (ABIN630361)

Antigène: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELOVL7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ELOVL7 anticorps

Purification: Purified

Immunogène: ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELOVL7 Blocking Peptide, (ABIN5613362), is also available for use as a blocking control in assays to test for specificity of this ELOVL7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELOVL7

Antigène: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Autre désignation: ELOVL7

Sujet: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.

Poids moléculaire: 33 kDa (MW of target protein)