SLC5A4 anticorps
-
- Antigène Voir toutes SLC5A4 Anticorps
- SLC5A4 (Solute Carrier Family 5 (Low Affinity Glucose Cotransporter), Member 4 (SLC5A4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC5A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SLC5 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
- Top Product
- Discover our top product SLC5A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC5A4 Blocking Peptide, catalog no. 33R-5766, is also available for use as a blocking control in assays to test for specificity of this SLC5A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC5A4 (Solute Carrier Family 5 (Low Affinity Glucose Cotransporter), Member 4 (SLC5A4))
- Autre désignation
- SLC5A4 (SLC5A4 Produits)
- Synonymes
- anticorps DJ90G24.4, anticorps SAAT1, anticorps SGLT3, anticorps PSGLT2, anticorps SLC5A4, anticorps Slc5a4a, anticorps solute carrier family 5 member 4, anticorps SLC5A4, anticorps Slc5a4
- Sujet
- SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter.
- Poids moléculaire
- 72 kDa (MW of target protein)
- Pathways
- Proton Transport
-