MAS1 anticorps (Middle Region)

N° du produit ABIN630411

Cet anticorps anti-MAS1 Polyclonal Lapin (ABIN630411) détecte spécifiquement MAS1 dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour MAS1 anticorps (Middle Region) (ABIN630411)

Antigène: MAS1 (MAS1 Oncogene (MAS1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAS1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MAS1 anticorps

Épitope: Middle Region

Specificité: MAS1 antibody was raised against the middle region of MAS1

Purification: Purified

Immunogène: MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAS1 Blocking Peptide, (ABIN5614675), is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAS1

Antigène: MAS1 (MAS1 Oncogene (MAS1))

Autre désignation: MAS1

Sujet: The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Regulation of Carbohydrate Metabolic Process