Aspartate beta Hydroxylase anticorps (N-Term)
-
- Antigène Voir toutes Aspartate beta Hydroxylase (ASPH) Anticorps
- Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Aspartate beta Hydroxylase est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ASPH antibody was raised against the N terminal of ASPH
- Purification
- Purified
- Immunogène
- ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE
- Top Product
- Discover our top product ASPH Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ASPH Blocking Peptide, catalog no. 33R-8411, is also available for use as a blocking control in assays to test for specificity of this ASPH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))
- Autre désignation
- ASPH (ASPH Produits)
- Synonymes
- anticorps AAH, anticorps BAH, anticorps CASQ2BP1, anticorps HAAH, anticorps JCTN, anticorps junctin, anticorps 2310005F16Rik, anticorps 3110001L23Rik, anticorps AI848629, anticorps AW261690, anticorps AW561901, anticorps C79816, anticorps cI-37, anticorps aah, anticorps bah, anticorps jctn, anticorps MGC107896, anticorps cb971, anticorps fb69e10, anticorps fc06d04, anticorps fc95a08, anticorps wu:fb69e10, anticorps wu:fc06d04, anticorps wu:fc95a08, anticorps aspartate beta-hydroxylase, anticorps aspartate-beta-hydroxylase, anticorps aspartate beta-hydroxylase L homeolog, anticorps ASPH, anticorps Asph, anticorps asph, anticorps asph.L
- Sujet
- ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-