SLC22A11 anticorps
-
- Antigène Voir toutes SLC22A11 Anticorps
- SLC22A11 (Solute Carrier Family 22 (Organic Cation Transporter), Member 11 (SLC22A11))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A11 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SLC22 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
- Top Product
- Discover our top product SLC22A11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A11 Blocking Peptide, catalog no. 33R-5653, is also available for use as a blocking control in assays to test for specificity of this SLC22A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A11 (Solute Carrier Family 22 (Organic Cation Transporter), Member 11 (SLC22A11))
- Autre désignation
- SLC22A11 (SLC22A11 Produits)
- Synonymes
- anticorps DKFZp469L1732, anticorps OAT4, anticorps hOAT4, anticorps solute carrier family 22 member 11, anticorps solute carrier family 22 member 24, anticorps SLC22A11, anticorps LOC100349650
- Sujet
- SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.
- Poids moléculaire
- 60 kDa (MW of target protein)
-