SLC22A7 anticorps

N° du produit ABIN630485

Détail du produit anti-SLC22A7 anticorps

Antigène: SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A7 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC22 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A7 Blocking Peptide, catalog no. 33R-5265, is also available for use as a blocking control in assays to test for specificity of this SLC22A7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC22A7

Antigène: SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))

Autre désignation: SLC22A7 (SLC22A7 Produits)

Synonymes: anticorps NLT, anticorps OAT2, anticorps Oat2, anticorps oat2, anticorps nlt, anticorps slc22a7, anticorps im:6901703, anticorps im:7155670, anticorps oat2a, anticorps zgc:162334, anticorps oat2e, anticorps slc22a7b, anticorps zgc:63958, anticorps solute carrier family 22 member 7, anticorps solute carrier family 22 (organic anion transporter), member 7, anticorps solute carrier family 22 (organic anion transporter), member 7 L homeolog, anticorps solute carrier family 22 (organic anion transporter), member 7a, anticorps solute carrier family 22 (organic anion transporter), member 7b, tandem duplicate 1, anticorps SLC22A7, anticorps Slc22a7, anticorps slc22a7.L, anticorps slc22a7a, anticorps slc22a7b.1

Sujet: SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.

Poids moléculaire: 60 kDa (MW of target protein)