C18orf54 anticorps

N° du produit ABIN630532

Détail du produit anti-C18orf54 anticorps

Antigène: C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C18orf54 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: C18 ORF54 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C18ORF54 Blocking Peptide, catalog no. 33R-7000, is also available for use as a blocking control in assays to test for specificity of this C18ORF54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C18orf54

Antigène: C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))

Autre désignation: C18ORF54 (C18orf54 Produits)

Synonymes: anticorps LAS2, anticorps 9930107F24, anticorps BB148262, anticorps Lars, anticorps Las2, anticorps chromosome 18 open reading frame 54, anticorps RIKEN cDNA 4930503L19 gene, anticorps c18orf54, anticorps C18orf54, anticorps 4930503L19Rik

Sujet: The function of C18orf54 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 58 kDa (MW of target protein)