IFI35 anticorps (N-Term)

N° du produit ABIN630552

Détail du produit anti-IFI35 anticorps

Antigène: IFI35 (Interferon-Induced Protein 35 (IFI35))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFI35 est non-conjugé

Application: Western Blotting (WB)

Specificité: IFI35 antibody was raised against the N terminal of IFI35

Purification: Affinity purified

Immunogène: IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFI35 Blocking Peptide, catalog no. 33R-6397, is also available for use as a blocking control in assays to test for specificity of this IFI35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFI35

Antigène: IFI35 (Interferon-Induced Protein 35 (IFI35))

Autre désignation: IFI35 (IFI35 Produits)

Synonymes: anticorps IFI35, anticorps IFP35, anticorps 2010008K16Rik, anticorps AW986054, anticorps ifi-35, anticorps interferon induced protein 35, anticorps interferon-induced protein 35, anticorps IFI35, anticorps ifi35, anticorps Ifi35

Sujet: IFI35 has been shown to interact with NMI and BATF.

Poids moléculaire: 32 kDa (MW of target protein)