TRMT5 anticorps

N° du produit ABIN630573

Détail du produit anti-TRMT5 anticorps

Antigène: TRMT5 (tRNA Methyltransferase 5 (TRMT5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRMT5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRMT5 Blocking Peptide, catalog no. 33R-2587, is also available for use as a blocking control in assays to test for specificity of this TRMT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRMT5

Antigène: TRMT5 (tRNA Methyltransferase 5 (TRMT5))

Autre désignation: TRMT5 (TRMT5 Produits)

Synonymes: anticorps RGD1306567, anticorps 2610027O18Rik, anticorps mKIAA1393, anticorps wu:fi28b08, anticorps KIAA1393, anticorps TRM5, anticorps tRNA methyltransferase 5, anticorps TRM5 tRNA methyltransferase 5, anticorps TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae), anticorps Trmt5, anticorps TRMT5, anticorps trmt5

Sujet: TRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine.

Poids moléculaire: 58 kDa (MW of target protein)