TNPO2 anticorps

N° du produit ABIN630589

Détail du produit anti-TNPO2 anticorps

Antigène: TNPO2 (Transportin 2 (TNPO2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNPO2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Transportin 2 Blocking Peptide, catalog no. 33R-5534, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNPO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNPO2

Antigène: TNPO2 (Transportin 2 (TNPO2))

Autre désignation: Transportin 2 (TNPO2 Produits)

Synonymes: anticorps TNPO2, anticorps IPO3, anticorps KPNB2B, anticorps TRN2, anticorps ik:tdsubc_2a7, anticorps tdsubc_2a7, anticorps wu:fb01c02, anticorps wu:fe01f03, anticorps wu:fe16e12, anticorps xx:tdsubc_2a7, anticorps zgc:101009, anticorps 1110034O24Rik, anticorps AA414969, anticorps AI464345, anticorps AI852433, anticorps Knpb2b, anticorps Kpnb2b, anticorps transportin 2, anticorps transportin 2 L homeolog, anticorps transportin 2 (importin 3, karyopherin beta 2b), anticorps TNPO2, anticorps tnpo2.L, anticorps Tnpo2, anticorps tnpo2

Sujet: Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Poids moléculaire: 100 kDa (MW of target protein)