SLA anticorps (Middle Region)

N° du produit ABIN630654

Détail du produit anti-SLA anticorps

Antigène: SLA (Src-Like-Adaptor (SLA))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLA est non-conjugé

Application: Western Blotting (WB)

Specificité: SLA1 antibody was raised against the middle region of SLA

Purification: Affinity purified

Immunogène: SLA1 antibody was raised using the middle region of SLA corresponding to a region with amino acids PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLA1 Blocking Peptide, catalog no. 33R-7045, is also available for use as a blocking control in assays to test for specificity of this SLA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLA

Antigène: SLA (Src-Like-Adaptor (SLA))

Autre désignation: SLA1 (SLA Produits)

Synonymes: anticorps SLA1, anticorps SLAP, anticorps src-like-adapter, anticorps SLA, anticorps Slap1, anticorps Slap, anticorps Slap-1, anticorps Src like adaptor, anticorps Src-like-adaptor, anticorps src-like adaptor, anticorps SLA, anticorps Sla

Sujet: SLA is an adapter protein, which negatively regulates T-cell receptor (TCR) signaling. SLA inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells.

Poids moléculaire: 31 kDa (MW of target protein)