SETDB2 anticorps (N-Term)

N° du produit ABIN630677

Détail du produit anti-SETDB2 anticorps

Antigène: SETDB2 (SET Domain, Bifurcated 2 (SETDB2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SETDB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SETDB2 antibody was raised against the N terminal of SETDB2

Purification: Affinity purified

Immunogène: SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SETDB2 Blocking Peptide, catalog no. 33R-1523, is also available for use as a blocking control in assays to test for specificity of this SETDB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETDB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SETDB2

Antigène: SETDB2 (SET Domain, Bifurcated 2 (SETDB2))

Autre désignation: SETDB2 (SETDB2 Produits)

Synonymes: anticorps C13orf4, anticorps CLLD8, anticorps CLLL8, anticorps KMT1F, anticorps Clld8, anticorps Gm293, anticorps SET domain bifurcated 2, anticorps SET domain, bifurcated 2, anticorps SETDB2, anticorps Setdb2

Sujet: Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.

Poids moléculaire: 77 kDa (MW of target protein)