PIN4 anticorps (Middle Region)

N° du produit ABIN630680

Détail du produit anti-PIN4 anticorps

Antigène: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: PIN4 antibody was raised against the middle region of PIN4

Purification: Affinity purified

Immunogène: PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIN4 Blocking Peptide, catalog no. 33R-5002, is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIN4

Antigène: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Autre désignation: PIN4 (PIN4 Produits)

Synonymes: anticorps 2410002I22Rik, anticorps EPVH, anticorps Par14, anticorps PAR14, anticorps PAR17, anticorps zgc:110008, anticorps peptidylprolyl cis/trans isomerase, NIMA-interacting 4, anticorps protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin), anticorps protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin), anticorps PIN4, anticorps Pin4, anticorps pin4

Sujet: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.

Poids moléculaire: 16 kDa (MW of target protein)