Trmt11 anticorps

N° du produit ABIN630683

Détail du produit anti-Trmt11 anticorps

Antigène: Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Trmt11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TRMT11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRMT11 Blocking Peptide, catalog no. 33R-4021, is also available for use as a blocking control in assays to test for specificity of this TRMT11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMT11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Trmt11

Antigène: Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))

Autre désignation: TRMT11 (Trmt11 Produits)

Synonymes: anticorps 2410075D05Rik, anticorps 3110045I18Rik, anticorps AW213713, anticorps Mds024, anticorps MDS024, anticorps C6orf75, anticorps TRM11, anticorps TRMT11-1, anticorps tRNA methyltransferase 11, anticorps tRNA methyltransferase 11 homolog, anticorps tRNA methyltransferase 11 homolog L homeolog, anticorps Trmt11, anticorps trmt11.L, anticorps TRMT11

Sujet: TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Poids moléculaire: 53 kDa (MW of target protein)