POLR3H anticorps (Middle Region)

N° du produit ABIN630707

Détail du produit anti-POLR3H anticorps

Antigène: POLR3H (Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR3H est non-conjugé

Application: Western Blotting (WB)

Specificité: POLR3 H antibody was raised against the middle region of POLR3

Purification: Affinity purified

Immunogène: POLR3 H antibody was raised using the middle region of POLR3 corresponding to a region with amino acids AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR3H Blocking Peptide, catalog no. 33R-1242, is also available for use as a blocking control in assays to test for specificity of this POLR3H antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR3H

Antigène: POLR3H (Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H))

Autre désignation: POLR3H (POLR3H Produits)

Synonymes: anticorps 5031409G22Rik, anticorps RPC8, anticorps RPC22.9, anticorps polymerase (RNA) III (DNA directed) polypeptide H, anticorps RNA polymerase III subunit H, anticorps Polr3h, anticorps POLR3H

Sujet: POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.

Poids moléculaire: 20 kDa (MW of target protein)