MORC3 anticorps (N-Term)

N° du produit ABIN630711

Détail du produit anti-MORC3 anticorps

Antigène: MORC3 (MORC Family CW-Type Zinc Finger 3 (MORC3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MORC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: MORC3 antibody was raised against the N terminal of MORC3

Purification: Affinity purified

Immunogène: MORC3 antibody was raised using the N terminal of MORC3 corresponding to a region with amino acids KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MORC3 Blocking Peptide, catalog no. 33R-4516, is also available for use as a blocking control in assays to test for specificity of this MORC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MORC3

Antigène: MORC3 (MORC Family CW-Type Zinc Finger 3 (MORC3))

Autre désignation: MORC3 (MORC3 Produits)

Synonymes: anticorps NXP2, anticorps ZCW5, anticorps ZCWCC3, anticorps 1110051N18Rik, anticorps AI452146, anticorps BF318192, anticorps D16Jhu32e, anticorps Zcwcc3, anticorps sb:cb561, anticorps sb:cb69, anticorps zgc:101052, anticorps fb73c08, anticorps wu:fb73c08, anticorps zgc:162471, anticorps morc3, anticorps MORC family CW-type zinc finger 3, anticorps microrchidia 3, anticorps MORC family CW-type zinc finger 3b, anticorps MORC family CW-type zinc finger 3a, anticorps MORC family CW-type zinc finger 3 S homeolog, anticorps MORC3, anticorps Morc3, anticorps morc3b, anticorps morc3a, anticorps morc3.S

Sujet: MORC3 localizes to the nuclear matrix. Also, MORC3 has RNA binding activity, and has a predicted coiled-coil domain. The protein also has RNA binding activity, and has a predicted coiled-coil domain.

Poids moléculaire: 107 kDa (MW of target protein)

Pathways: Maintenance of Protein Location