RORC anticorps (N-Term)

N° du produit ABIN630715

Détail du produit anti-RORC anticorps

Antigène: RORC (RAR-Related Orphan Receptor C (RORC))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RORC est non-conjugé

Application: Western Blotting (WB)

Specificité: RORC antibody was raised against the N terminal of RORC

Purification: Affinity purified

Immunogène: RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RORC Blocking Peptide, catalog no. 33R-2655, is also available for use as a blocking control in assays to test for specificity of this RORC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RORC

Antigène: RORC (RAR-Related Orphan Receptor C (RORC))

Autre désignation: RORC (RORC Produits)

Synonymes: anticorps NR1F3, anticorps RORG, anticorps RZR-GAMMA, anticorps RZRG, anticorps TOR, anticorps Nr1f3, anticorps RORgamma, anticorps Thor, anticorps RAR related orphan receptor C, anticorps RAR-related orphan receptor C, anticorps RAR-related orphan receptor gamma, anticorps RORC, anticorps Rorc

Sujet: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known, however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway