IVNS1ABP anticorps (N-Term)
-
- Antigène Voir toutes IVNS1ABP Anticorps
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
-
Épitope
- N-Term
-
Reactivité
- Influenza A Virus
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IVNS1ABP est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Influenza Virus Ns1 A Binding Protein antibody was raised against the N terminal of IVNS1 BP
- Réactivité croisée
- Humain, Chien
- Purification
- Affinity purified
- Immunogène
- Influenza Virus Ns1 A Binding Protein antibody was raised using the N terminal of IVNS1 BP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
- Top Product
- Discover our top product IVNS1ABP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Influenza Virus Ns1A Binding Protein Blocking Peptide, catalog no. 33R-7827, is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVNS0 BP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
- Autre désignation
- Influenza Virus Ns1A Binding Protein (IVNS1ABP Produits)
- Synonymes
- anticorps 1190004M08Rik, anticorps 1700126I16Rik, anticorps AA960440, anticorps HSPC068, anticorps ND1, anticorps NS-1, anticorps NS1-BP, anticorps Nd1-L, anticorps Nd1-S, anticorps mKIAA0850, anticorps cb1052, anticorps fj23g11, anticorps ivns1abp, anticorps wu:fj23g11, anticorps FLARA3, anticorps KLHL39, anticorps NS1BP, anticorps fi13f08, anticorps fi41c09, anticorps wu:fi13f08, anticorps wu:fi41c09, anticorps influenza virus NS1A binding protein, anticorps influenza virus NS1A binding protein a, anticorps influenza virus NS1A binding protein L homeolog, anticorps influenza virus NS1A binding protein b, anticorps Ivns1abp, anticorps ivns1abpa, anticorps ivns1abp.L, anticorps IVNS1ABP, anticorps ivns1abpb
- Classe de substances
- Influenza Protein
- Sujet
- This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.
- Poids moléculaire
- 72 kDa (MW of target protein)
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-