GSTT1 anticorps (C-Term)

N° du produit ABIN630730

Détail du produit anti-GSTT1 anticorps

Antigène: GSTT1 (Glutathione S-Transferase theta 1 (GSTT1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSTT1 antibody was raised against the C terminal of GSTT1

Purification: Affinity purified

Immunogène: GSTT1 antibody was raised using the C terminal of GSTT1 corresponding to a region with amino acids TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTT1 Blocking Peptide, catalog no. 33R-9381, is also available for use as a blocking control in assays to test for specificity of this GSTT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTT1

Antigène: GSTT1 (Glutathione S-Transferase theta 1 (GSTT1))

Autre désignation: GSTT1 (GSTT1 Produits)

Synonymes: anticorps GSTT1, anticorps LOC100285763, anticorps cb870, anticorps gstt1, anticorps AI255817, anticorps Gstt1-1, anticorps GSTYRS, anticorps zgc:65964, anticorps glutathione S-transferase theta 1, anticorps glutathione S-transferase theta-4, anticorps glutathione S-transferase theta-1, anticorps glutathione S-transferase theta 1a, anticorps glutathione S-transferase, theta 1, anticorps glutathione S-transferase theta 1 L homeolog, anticorps glutathione S-transferase theta 1b, anticorps GSTT1, anticorps LOC700446, anticorps LOC100285763, anticorps gstt1a, anticorps Gstt1, anticorps LOC477556, anticorps LOC100153094, anticorps LOC100338194, anticorps gstt1.L, anticorps gstt1b

Sujet: Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis.

Poids moléculaire: 27 kDa (MW of target protein)