Peroxiredoxin 3 anticorps (N-Term)

N° du produit ABIN630744

Détail du produit anti-Peroxiredoxin 3 anticorps

Antigène: Peroxiredoxin 3 (PRDX3)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: Peroxiredoxin 3 antibody was raised against the N terminal of PRDX3

Purification: Affinity purified

Immunogène: Peroxiredoxin 3 antibody was raised using the N terminal of PRDX3 corresponding to a region with amino acids AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Peroxiredoxin 3 Blocking Peptide, catalog no. 33R-1279, is also available for use as a blocking control in assays to test for specificity of this Peroxiredoxin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of Peroxiredoxin 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peroxiredoxin 3

Antigène: Peroxiredoxin 3 (PRDX3)

Autre désignation: Peroxiredoxin 3 (PRDX3 Produits)

Synonymes: anticorps cb718, anticorps wu:fk49e09, anticorps zgc:110282, anticorps zgc:112512, anticorps MGC83969, anticorps PRDX3, anticorps AOP-1, anticorps AOP1, anticorps HBC189, anticorps MER5, anticorps PRO1748, anticorps SP-22, anticorps prx-III, anticorps AW822249, anticorps Aop1, anticorps D0Tohi1, anticorps Ef2l, anticorps Mer5, anticorps Prx3, anticorps SP22, anticorps TDXM, anticorps MTAP, anticorps peroxiredoxin 3, anticorps peroxiredoxin 3 S homeolog, anticorps peroxiredoxin PRX3, anticorps prdx3, anticorps PRDX3, anticorps prdx3.S, anticorps PRX3, anticorps Prdx3

Sujet: PRDX3 is a protein with antioxidant function and is localized in the mitochondrion. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process