HIRIP3 anticorps (Middle Region)

N° du produit ABIN630758

Détail du produit anti-HIRIP3 anticorps

Antigène: HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HIRIP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: HIRIP3 antibody was raised against the middle region of HIRIP3

Purification: Affinity purified

Immunogène: HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HIRIP3 Blocking Peptide, catalog no. 33R-8235, is also available for use as a blocking control in assays to test for specificity of this HIRIP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIRIP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HIRIP3

Antigène: HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))

Autre désignation: HIRIP3 (HIRIP3 Produits)

Synonymes: anticorps HIRIP3, anticorps fi16e03, anticorps wu:fi16e03, anticorps zgc:66480, anticorps B130036O03, anticorps C86302, anticorps HIRA interacting protein 3, anticorps HIRIP3, anticorps hirip3, anticorps Hirip3

Sujet: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae.

Poids moléculaire: 61 kDa (MW of target protein)