CCDC50 anticorps (Middle Region)
-
- Antigène Voir toutes CCDC50 Anticorps
- CCDC50 (Coiled-Coil Domain Containing 50 (CCDC50))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCDC50 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CCDC50 antibody was raised against the middle region of CCDC50
- Purification
- Affinity purified
- Immunogène
- CCDC50 antibody was raised using the middle region of CCDC50 corresponding to a region with amino acids GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV
- Top Product
- Discover our top product CCDC50 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CCDC50 Blocking Peptide, catalog no. 33R-3435, is also available for use as a blocking control in assays to test for specificity of this CCDC50 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC50 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CCDC50 (Coiled-Coil Domain Containing 50 (CCDC50))
- Autre désignation
- CCDC50 (CCDC50 Produits)
- Synonymes
- anticorps ymer, anticorps C3orf6, anticorps DFNA44, anticorps YMER, anticorps 2610529H08Rik, anticorps 5730448P06Rik, anticorps AW048328, anticorps AW546090, anticorps D16Bwg1543e, anticorps C3orf6h, anticorps c3orf6, anticorps coiled-coil domain containing 50, anticorps coiled-coil domain containing 50 L homeolog, anticorps CCDC50, anticorps ccdc50.L, anticorps ccdc50, anticorps Ccdc50
- Sujet
- CCDC50 is a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling.
- Poids moléculaire
- 56 kDa (MW of target protein)
-