NHEDC1 anticorps (N-Term)

N° du produit ABIN630833

Détail du produit anti-NHEDC1 anticorps

Antigène: NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NHEDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NHEDC1 antibody was raised against the N terminal of NHEDC1

Purification: Affinity purified

Immunogène: NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NHEDC1 Blocking Peptide, catalog no. 33R-6104, is also available for use as a blocking control in assays to test for specificity of this NHEDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NHEDC1

Antigène: NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))

Autre désignation: NHEDC1 (NHEDC1 Produits)

Synonymes: anticorps NHA1, anticorps NHEDC1, anticorps 1700094G20Rik, anticorps 4933424B12Rik, anticorps 4933425K02Rik, anticorps AV258602, anticorps Nhedc1, anticorps mtsNHE, anticorps solute carrier family 9 member B1, anticorps solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1, anticorps SLC9B1, anticorps Slc9b1

Sujet: NHEDC1 is a sodium/hydrogen exchanger and transmembrane protein. Highly conserved orthologs of this gene have been found in other mammalian species. The expression of NHEDC1 may be limited to testis.

Poids moléculaire: 52 kDa (MW of target protein)