ENO3 anticorps

N° du produit ABIN630836

Détail du produit anti-ENO3 anticorps

Antigène: ENO3 (Enolase 3 (Beta, Muscle) (ENO3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENO3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Enolase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Enolase 3 Blocking Peptide, catalog no. 33R-2776, is also available for use as a blocking control in assays to test for specificity of this Enolase 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENO3

Antigène: ENO3 (Enolase 3 (Beta, Muscle) (ENO3))

Autre désignation: Enolase 3 (ENO3 Produits)

Synonymes: anticorps ENO3, anticorps GSD13, anticorps MSE, anticorps ENO1, anticorps cb883, anticorps fj24f12, anticorps wu:fj24f12, anticorps Eno-3, anticorps BBE, anticorps enolase 3 (beta, muscle) L homeolog, anticorps enolase 3, anticorps enolase 3 (beta, muscle), anticorps enolase 3, (beta, muscle), anticorps enolase 3, beta muscle, anticorps eno3.L, anticorps ENO3, anticorps eno3, anticorps Eno3

Sujet: ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.

Poids moléculaire: 47 kDa (MW of target protein)