TRIML1 anticorps (Middle Region)

N° du produit ABIN630846

Détail du produit anti-TRIML1 anticorps

Antigène: TRIML1 (Tripartite Motif Family-Like 1 (TRIML1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIML1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIML1 antibody was raised against the middle region of TRIML1

Purification: Affinity purified

Immunogène: TRIML1 antibody was raised using the middle region of TRIML1 corresponding to a region with amino acids DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIML1 Blocking Peptide, catalog no. 33R-2184, is also available for use as a blocking control in assays to test for specificity of this TRIML1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIML1

Antigène: TRIML1 (Tripartite Motif Family-Like 1 (TRIML1))

Autre désignation: TRIML1 (TRIML1 Produits)

Synonymes: anticorps RNF209, anticorps 4933403D14, anticorps BC050188, anticorps RGD1305337, anticorps tripartite motif family-like 1, anticorps tripartite motif family like 1, anticorps TRIML1, anticorps Triml1

Sujet: TRIML1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of the TRIML1 protein remains unknown.

Poids moléculaire: 53 kDa (MW of target protein)