NARF anticorps (Middle Region)

N° du produit ABIN630867

Cet anticorps anti-NARF Polyclonal Lapin (ABIN630867) détecte spécifiquement NARF dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour NARF anticorps (Middle Region) (ABIN630867)

Antigène: NARF (Nuclear Prelamin A Recognition Factor (NARF))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NARF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NARF anticorps

Épitope: Middle Region

Specificité: NARF antibody was raised against the middle region of NARF

Purification: Affinity purified

Immunogène: NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NARF Blocking Peptide, (ABIN938440), is also available for use as a blocking control in assays to test for specificity of this NARF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NARF

Antigène: NARF (Nuclear Prelamin A Recognition Factor (NARF))

Autre désignation: NARF

Sujet: NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.

Poids moléculaire: 55 kDa (MW of target protein)