NARF anticorps (Middle Region)
-
- Antigène Voir toutes NARF Anticorps
- NARF (Nuclear Prelamin A Recognition Factor (NARF))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NARF est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NARF antibody was raised against the middle region of NARF
- Purification
- Affinity purified
- Immunogène
- NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR
- Top Product
- Discover our top product NARF Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NARF Blocking Peptide, catalog no. 33R-3054, is also available for use as a blocking control in assays to test for specificity of this NARF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NARF (Nuclear Prelamin A Recognition Factor (NARF))
- Autre désignation
- NARF (NARF Produits)
- Synonymes
- anticorps NARF, anticorps IOP2, anticorps 4430402O11Rik, anticorps RGD1310894, anticorps wu:fa03c01, anticorps zgc:92186, anticorps nuclear prelamin A recognition factor, anticorps nuclear prelamin A recognition factor L homeolog, anticorps NARF, anticorps NAEGRDRAFT_78871, anticorps VDBG_04882, anticorps Tsp_07547, anticorps Tsp_07549, anticorps Narf, anticorps narf, anticorps narf.L
- Sujet
- NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.
- Poids moléculaire
- 55 kDa (MW of target protein)
-