GLE1 anticorps
-
- Antigène Voir toutes GLE1 Anticorps
- GLE1 (GLE1 RNA Export Mediator (GLE1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GLE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ
- Top Product
- Discover our top product GLE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLE1 Blocking Peptide, catalog no. 33R-5089, is also available for use as a blocking control in assays to test for specificity of this GLE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLE1 (GLE1 RNA Export Mediator (GLE1))
- Autre désignation
- GLE1 (GLE1 Produits)
- Synonymes
- anticorps Dmel\\CG14749, anticorps GLE1, anticorps GLE1L, anticorps LCCS, anticorps LCCS1, anticorps hGLE1, anticorps Gle1l, anticorps 4933405K21Rik, anticorps AA553313, anticorps CG14749 gene product from transcript CG14749-RA, anticorps nucleoporin GLE1, anticorps RNA export factor Gle1, anticorps GLE1, RNA export mediator, anticorps GLE1 RNA export mediator, anticorps GLE1 RNA export mediator (yeast), anticorps CG14749, anticorps CpipJ_CPIJ014147, anticorps SJAG_03847, anticorps GLE1, anticorps Gle1
- Sujet
- GLE1 is a predicted 75 kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes.
- Poids moléculaire
- 75 kDa (MW of target protein)
-