GCET2 anticorps (Middle Region)
-
- Antigène Voir toutes GCET2 Anticorps
- GCET2 (Germinal Center Expressed Transcript 2 (GCET2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GCET2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GCET2 antibody was raised against the middle region of GCET2
- Purification
- Affinity purified
- Immunogène
- GCET2 antibody was raised using the middle region of GCET2 corresponding to a region with amino acids YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH
- Top Product
- Discover our top product GCET2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GCET2 Blocking Peptide, catalog no. 33R-10243, is also available for use as a blocking control in assays to test for specificity of this GCET2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCET2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GCET2 (Germinal Center Expressed Transcript 2 (GCET2))
- Autre désignation
- GCET2 (GCET2 Produits)
- Synonymes
- anticorps Gcet, anticorps Gcet2, anticorps M17, anticorps M17-L, anticorps GCAT2, anticorps GCET2, anticorps HGAL, anticorps germinal center associated, signaling and motility, anticorps germinal center associated signaling and motility, anticorps germinal center-associated, signaling and motility, anticorps Gcsam, anticorps GCSAM
- Sujet
- GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.
- Poids moléculaire
- 21 kDa (MW of target protein)
-