GCET2 anticorps (Middle Region)

N° du produit ABIN630927

Détail du produit anti-GCET2 anticorps

Antigène: GCET2 (Germinal Center Expressed Transcript 2 (GCET2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCET2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GCET2 antibody was raised against the middle region of GCET2

Purification: Affinity purified

Immunogène: GCET2 antibody was raised using the middle region of GCET2 corresponding to a region with amino acids YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCET2 Blocking Peptide, catalog no. 33R-10243, is also available for use as a blocking control in assays to test for specificity of this GCET2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCET2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCET2

Antigène: GCET2 (Germinal Center Expressed Transcript 2 (GCET2))

Autre désignation: GCET2 (GCET2 Produits)

Synonymes: anticorps Gcet, anticorps Gcet2, anticorps M17, anticorps M17-L, anticorps GCAT2, anticorps GCET2, anticorps HGAL, anticorps germinal center associated, signaling and motility, anticorps germinal center associated signaling and motility, anticorps germinal center-associated, signaling and motility, anticorps Gcsam, anticorps GCSAM

Sujet: GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.

Poids moléculaire: 21 kDa (MW of target protein)