ATP6V1E2 anticorps (Middle Region)
-
- Antigène Voir toutes ATP6V1E2 Anticorps
- ATP6V1E2 (ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP6V1E2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2
- Purification
- Affinity purified
- Immunogène
- ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
- Top Product
- Discover our top product ATP6V1E2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP6V1E2 Blocking Peptide, catalog no. 33R-5212, is also available for use as a blocking control in assays to test for specificity of this ATP6V1E2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP6V1E2 (ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2))
- Autre désignation
- ATP6V1E2 (ATP6V1E2 Produits)
- Synonymes
- anticorps ATP6E1, anticorps ATP6EL2, anticorps ATP6V1EL2, anticorps VMA4, anticorps 4930500C14Rik, anticorps Atp6e1, anticorps E1, anticorps ATPase H+ transporting V1 subunit E2, anticorps ATPase, H+ transporting, lysosomal V1 subunit E2, anticorps Atp6v1e2, anticorps ATP6V1E2
- Sujet
- ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport
-