KPNA1 anticorps

N° du produit ABIN630936

Détail du produit anti-KPNA1 anticorps

Antigène: KPNA1 (Karyopherin alpha 1 (Importin alpha 5) (KPNA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPNA1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Karyopherin Alpha 1 Blocking Peptide, catalog no. 33R-9327, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPNA1

Antigène: KPNA1 (Karyopherin alpha 1 (Importin alpha 5) (KPNA1))

Autre désignation: Karyopherin alpha 1 (KPNA1 Produits)

Synonymes: anticorps IPOA5, anticorps NPI-1, anticorps RCH2, anticorps SRP1, anticorps AW494490, anticorps NPI1, anticorps Rch2, anticorps mSRP1, anticorps si:ch211-161h7.7, anticorps karyopherin subunit alpha 1, anticorps importin alpha-1 subunit, anticorps karyopherin (importin) alpha 1, anticorps karyopherin alpha 1 (importin alpha 5), anticorps KPNA1, anticorps Kpna1, anticorps EHI_124900, anticorps kpna1

Sujet: Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus