TXN2 anticorps (Middle Region)

N° du produit ABIN631005

Détail du produit anti-TXN2 anticorps

Antigène: TXN2 (Thioredoxin 2 (TXN2))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TXN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Thioredoxin 2 antibody was raised against the middle region of TXN2

Purification: Affinity purified

Immunogène: Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Thioredoxin 2 Blocking Peptide, catalog no. 33R-7579, is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TXN2

Antigène: TXN2 (Thioredoxin 2 (TXN2))

Autre désignation: Thioredoxin 2 (TXN2 Produits)

Synonymes: anticorps MT-TRX, anticorps MTRX, anticorps TRX2, anticorps 31884, anticorps CG31884, anticorps CG3864, anticorps DTrx-2, anticorps DmTrx-2, anticorps DmelTrx-2, anticorps Dmel\\CG31884, anticorps Trx, anticorps anon-WO0118547.188, anticorps dmtrx-2, anticorps 2510006J11Rik, anticorps AI788873, anticorps Trx2, anticorps zgc:77127, anticorps thioredoxin 2, anticorps thioredoxin-2, anticorps thiol reductase thioredoxin, anticorps thioredoxin 2 L homeolog, anticorps TXN2, anticorps Trx-2, anticorps LOC409451, anticorps VPA0972, anticorps VS_RS18125, anticorps VCD_000568, anticorps VEA_000083, anticorps trx2, anticorps Txn2, anticorps txn2, anticorps txn2.L

Sujet: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.

Poids moléculaire: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis