TXN2 anticorps (Middle Region)
-
- Antigène Voir toutes TXN2 Anticorps
- TXN2 (Thioredoxin 2 (TXN2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TXN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Thioredoxin 2 antibody was raised against the middle region of TXN2
- Purification
- Affinity purified
- Immunogène
- Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ
- Top Product
- Discover our top product TXN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Thioredoxin 2 Blocking Peptide, catalog no. 33R-7579, is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TXN2 (Thioredoxin 2 (TXN2))
- Autre désignation
- Thioredoxin 2 (TXN2 Produits)
- Synonymes
- anticorps MT-TRX, anticorps MTRX, anticorps TRX2, anticorps 31884, anticorps CG31884, anticorps CG3864, anticorps DTrx-2, anticorps DmTrx-2, anticorps DmelTrx-2, anticorps Dmel\\CG31884, anticorps Trx, anticorps anon-WO0118547.188, anticorps dmtrx-2, anticorps 2510006J11Rik, anticorps AI788873, anticorps Trx2, anticorps zgc:77127, anticorps thioredoxin 2, anticorps thioredoxin-2, anticorps thiol reductase thioredoxin, anticorps thioredoxin 2 L homeolog, anticorps TXN2, anticorps Trx-2, anticorps LOC409451, anticorps VPA0972, anticorps VS_RS18125, anticorps VCD_000568, anticorps VEA_000083, anticorps trx2, anticorps Txn2, anticorps txn2, anticorps txn2.L
- Sujet
- TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.
- Poids moléculaire
- 12 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-