GPX4 anticorps

N° du produit ABIN631020

Détail du produit anti-GPX4 anticorps

Antigène: GPX4 (Glutathione Peroxidase 4 (GPX4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPX4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPX4 Blocking Peptide, catalog no. 33R-7765, is also available for use as a blocking control in assays to test for specificity of this GPX4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPX4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPX4

Antigène: GPX4 (Glutathione Peroxidase 4 (GPX4))

Autre désignation: GPX4 (GPX4 Produits)

Synonymes: anticorps GPx-4, anticorps GSHPx-4, anticorps MCSP, anticorps PHGPx, anticorps snGPx, anticorps snPHGPx, anticorps Phgpx, anticorps gpx-4, anticorps snGpx, anticorps cb563, anticorps cb691, anticorps PHGPxa, anticorps sb:cb563, anticorps zgc:92253, anticorps wu:fb82e03, anticorps 1700027O09Rik, anticorps mtPHGPx, anticorps ATGPX4, anticorps F11L15.5, anticorps glutathione peroxidase 4, anticorps GP-GPx4, anticorps glutathione peroxidase 4, anticorps glutathione peroxidase 4a, anticorps GPX4, anticorps Gpx4, anticorps gpx4a

Sujet: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Poids moléculaire: 22 kDa (MW of target protein)