MMADHC anticorps (Middle Region)
-
- Antigène Voir toutes MMADHC Anticorps
- MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MMADHC est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C2 ORF25 antibody was raised against the middle region of C2 rf25
- Purification
- Affinity purified
- Immunogène
- C2 ORF25 antibody was raised using the middle region of C2 rf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI
- Top Product
- Discover our top product MMADHC Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C2ORF25 Blocking Peptide, catalog no. 33R-7803, is also available for use as a blocking control in assays to test for specificity of this C2ORF25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))
- Autre désignation
- C2ORF25 (MMADHC Produits)
- Synonymes
- anticorps C2orf25, anticorps CL25022, anticorps cblD, anticorps 2010311D03Rik, anticorps AI314967, anticorps RGD1303272, anticorps methylmalonic aciduria and homocystinuria, cblD type, anticorps methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria, anticorps MMADHC, anticorps Mmadhc
- Sujet
- Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.
- Poids moléculaire
- 33 kDa (MW of target protein)
-